PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_140579g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 352aa    MW: 40128.7 Da    PI: 6.8637
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_140579g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.8e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd llv++++ +G g+W++ +++ g++R++k+c++rw++yl
   MA_140579g0010 14 KGAWSAEEDNLLVKYIQTHGEGNWRSLPKKAGLRRCGKSCRLRWLNYL 61
                     79********************************************97 PP

2Myb_DNA-binding49.87.7e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E+el+++ +++lG++ W+ Ia +++ gRt++++k++w++
   MA_140579g0010  67 RGNITADEEELIIRMHALLGNR-WSIIAGRVP-GRTDNEIKNHWNT 110
                      7999******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.907961IPR017930Myb domain
SuperFamilySSF466891.5E-2911108IPR009057Homeodomain-like
SMARTSM007175.7E-151363IPR001005SANT/Myb domain
PfamPF002498.4E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-231568IPR009057Homeodomain-like
CDDcd001673.97E-111661No hitNo description
PROSITE profilePS5129424.61562116IPR017930Myb domain
SMARTSM007173.0E-1566114IPR001005SANT/Myb domain
PfamPF002497.6E-1467110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-2369116IPR009057Homeodomain-like
CDDcd001672.13E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGRAPCCSKV GVNKGAWSAE EDNLLVKYIQ THGEGNWRSL PKKAGLRRCG KSCRLRWLNY  60
LRPCIKRGNI TADEEELIIR MHALLGNRWS IIAGRVPGRT DNEIKNHWNT KLSRKLASRG  120
IDPKTHKFIT MDSSNRAGDR FNQFQSEKQY YCSRRSQHLV SNVVKVGRST DLVIPHVHNL  180
KADLKVQETE NKSSNRSLPV ESHNTNISMS SDECYNYTPA DSAECASLIN SSDSVEAKCD  240
SRDLHDNGCH WNEKHDEFPE YDVFNFFDVS NAENEICCND DYWVDEESAD QFVKQKQAPP  300
QSGQWDKQID FLSLPHMHSE TTVWEQSEIL MNPDFRTPAS ALTLPVTHGQ NG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU1312220.0KU131222.1 Picea abies transcription factor MYB33 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLD5AC040.0D5AC04_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.15e-68myb domain protein 3